PDB entry 1ns3

View 1ns3 on RCSB PDB site
Description: structure of hcv protease (bk strain)
Deposited on 1997-04-05, released 1998-04-08
The last revision prior to the SCOP 1.61 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.204
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1ns3.1
  • Chain 'B':
    Domains in SCOP 1.61: d1ns3.2
  • Chain 'C':
    Domains in SCOP 1.61: d1ns3.1
  • Chain 'D':
    Domains in SCOP 1.61: d1ns3.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ns3A (A:)
    itaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsk
    tlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgds
    rgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ns3B (B:)
    itaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsk
    tlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgds
    rgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ns3C (C:)
    kgsvvivgriils
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ns3D (D:)
    kgsvvivgriils