PDB entry 1nrh

View 1nrh on RCSB PDB site
Description: crystal structure of glva gene product from bacillus subtilis, a metal-requiring, nad-dependent 6-phospho-alpha-glucosidase
Deposited on 2003-01-24, released 2003-11-18
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.199
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1nrhX (X:)
    mhhhhhhssgvdlgtenlyfqsnmkkksfsiviagggstftpgivlmlldhleefpirkl
    klydndkerqdriagacdvfirekapdiefaattdpeeaftdvdfvmahirvgkyamral
    deqiplkygvvgqetcgpggiaygmrsiggvleildymekyspdawmlnysnpaaivaea
    trrlrpnskilnicdmpvgiedrmaqilglssrkemkvryyglnhfgwwtsiqdqegndl
    mpklkehvsqygyipkteaeaveaswndtfakardvqaadpdtlpntylqyylfpddmvk
    ksnpnhtranevmegreafifsqcdmitreqssenseikiddhasyivdlaraiayntge
    rmllivenngaianfdptamvevpcivgsngpepitvgtipqfqkglmeqqvsvekltve
    awaeksfqklwqalilsktvpnarvarliledlveankdfwpeldqsptris
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nrhX (X:)
    kksfsiviagggstftpgivlmlldhleefpirklklydndkerqdriagacdvfireka
    pdiefaattdpeeaftdvdfvmahirvgkyamraldeqiplkygvvgqetcgpggiaygm
    rsiggvleildymekyspdawmlnysnpaaivaeatrrlrpnskilnicdmpvgiedrma
    qilglssrkemkvryyglnhfgwwtsiqdqegndlmpklkehvsqygyipktswndtfak
    ardvqaadpdtlpntylqyylfpddmvkksnpnhtranevmegreafifsqcdmitreqs
    senseikiddhasyivdlaraiayntgermllivenngaianfdptamvevpcivgsngp
    epitvgtipqfqkglmeqqvsvekltveawaeksfqklwqalilsktvpnarvarliled
    lveankdfwpeldqsp