PDB entry 1nrc

View 1nrc on RCSB PDB site
Description: crystal structure of the rna-binding domain of the u1 small nuclear ribonucleoprotein a
Deposited on 1992-03-12, released 1994-01-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: -1.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1nrca_
  • Chain 'B':
    Domains in SCOP 1.57: d1nrcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nrcA (A:)
    trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmricyaktd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nrcB (B:)
    trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmricyak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nrcB (B:)
    trpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslgqafvifkevssatna
    lrsmqgfpfydkpmricyak