PDB entry 1nra

View 1nra on RCSB PDB site
Description: solution structure of an old world-like neurotoxin from the venom of the new world scorpion centruroides sculpturatus ewing
Class: neurotoxin
Keywords: neurotoxin
Deposited on 1995-01-03, released 1995-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neurotoxin v, cse-v
  Species: Centruroides sculpturatus [TaxId:218467]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46066 (0-62)
  Domains in SCOPe 2.08: d1nraa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nraA (A:)
  kkdgypvdsgnckyeclkddycndlclerkadkgycywgkvscycyglpdnsptktsgkc
  npa