PDB entry 1nr1

View 1nr1 on RCSB PDB site
Description:
Deposited on 2003-01-23, released 2003-05-06
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-06, with a file datestamp of 2003-05-06.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.222
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nr1a1, d1nr1a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nr1b1, d1nr1b2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nr1c1, d1nr1c2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nr1d1, d1nr1d2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nr1e1, d1nr1e2
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nr1f1, d1nr1f2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nr1A (A:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmeasarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nr1B (B:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmeasarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nr1C (C:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmeasarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nr1D (D:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmeasarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nr1E (E:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmeasarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nr1F (F:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmeasarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft