PDB entry 1nqt

View 1nqt on RCSB PDB site
Description: crystal structure of bovine glutamate dehydrogenase-adp complex
Deposited on 2003-01-23, released 2003-05-06
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-19, with a file datestamp of 2003-08-19.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.207
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqtA (A:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqtB (B:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqtC (C:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqtD (D:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqtE (E:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqtF (F:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqtG (G:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqtH (H:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqtI (I:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqtJ (J:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqtK (K:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nqtL (L:)
    dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
    rrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
    kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
    tighydinahacvtgkpisqggihgrisatgrgvfhgienfineasymsilgmtpgfgdk
    tfvvqgfgnvglhsmrylhrfgakciavgesdgsiwnpdgidpkeledfklqhgsilgfp
    kakpyegsileadcdilipaasekqltksnaprvkakiiaegangpttpeadkiflerni
    mvipdlylnaggvtvsyfewlknlnhvsygrltfkyerdsnyhllmsvqeslerkfgkhg
    gtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrtaayvna
    iekvfkvyneagvtft