PDB entry 1nqb

View 1nqb on RCSB PDB site
Description: trivalent antibody fragment
Class: immunoglobulin
Keywords: antibody fragment, multivalent antibody, diabody, domain swapping, immunoglobulin
Deposited on 1997-04-04, released 1997-08-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.187
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single-chain antibody fragment
    Species: Mus musculus [TaxId:10090]
    Gene: B1-8 VH DOMAIN FUSED TO NQ11 V
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nqba1, d1nqba2
  • Chain 'C':
    Compound: single-chain antibody fragment
    Species: Mus musculus [TaxId:10090]
    Gene: B1-8 VH DOMAIN FUSED TO NQ11 V
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nqbc1, d1nqbc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nqbA (A:)
    qvqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss
    dieltqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikraaaeqkl
    iseedlngaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nqbA (A:)
    vqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtkyn
    ekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvssd
    ieltqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrfs
    gvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nqbC (C:)
    qvqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss
    dieltqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikraaaeqkl
    iseedlngaahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nqbC (C:)
    vqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtkyn
    ekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvssd
    ieltqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrfs
    gvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr