PDB entry 1npn

View 1npn on RCSB PDB site
Description: Crystal structure of a copper reconstituted H145A mutant of nitrite reductase from Alcaligenes faecalis
Class: oxidoreductase
Keywords: copper nitrite reductase, OXIDOREDUCTASE
Deposited on 2003-01-18, released 2003-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.156
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: NIRK OR NIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501
      • engineered (147)
    Domains in SCOPe 2.07: d1npna1, d1npna2
  • Chain 'B':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: NIRK OR NIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501
      • engineered (147)
    Domains in SCOPe 2.07: d1npnb1, d1npnb2
  • Chain 'C':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: NIRK OR NIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501
      • engineered (147)
    Domains in SCOPe 2.07: d1npnc1, d1npnc2
  • Heterogens: CU, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1npnA (A:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1npnA (A:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1npnB (B:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1npnB (B:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1npnC (C:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1npnC (C:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg