PDB entry 1nog

View 1nog on RCSB PDB site
Description: Crystal Structure of Conserved Protein 0546 from Thermoplasma Acidophilum
Deposited on 2003-01-16, released 2003-07-29
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-29, with a file datestamp of 2003-07-29.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.197
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1noga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nogA (A:)
    mftrrgdqgetdlanrarvgkdspvvevqgtidelnsfigyalvlsrwddirndlfriqn
    dlfvlgedvstggkgrtvtremidylearvkemkaeigkielfvvpggsvesaslhmara
    vsrrlerrivaasklteinknvliyanrlssilfmhalisnkrlnipekiwsihrvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nogA (A:)
    spvvevqgtidelnsfigyalvlsrwddirndlfriqndlfvlgedvstggkgrtvtrem
    idylearvkemkaeigkielfvvpggsvesaslhmaravsrrlerrivaasklteinknv
    liyanrlssilfmhalisnkrlnipekiw