PDB entry 1no8

View 1no8 on RCSB PDB site
Description: solution structure of the nuclear factor aly rbd domain
Deposited on 2003-01-15, released 2003-08-12
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-12, with a file datestamp of 2003-08-12.
Experiment type: NMR32
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1no8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1no8A (A:)
    srpkqlpdkwqhdlfdsgfgggagvetggkllvsnldfgvsdadiqelfaefgtlkkaav
    hydrsgrslgtadvhferkadalkamkqyngvpldgrpmniqlvts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1no8A (A:)
    gkllvsnldfgvsdadiqelfaefgtlkkaavhydrsgrslgtadvhferkadalkamkq
    yngvpldgrpmniqlvts