PDB entry 1nmb

View 1nmb on RCSB PDB site
Description: the structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody
Deposited on 1995-01-17, released 1995-09-15
The last revision prior to the SCOP 1.65 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.21
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.65: d1nmbh_
  • Chain 'L':
    Domains in SCOP 1.65: d1nmbl_
  • Chain 'N':
    Domains in SCOP 1.65: d1nmbn_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmbH (H:)
    qvqlqqpgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
    nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttltv
    ss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmbL (L:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
    rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtkleirra
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1nmbN (N:)
    mnpnqkilctsatalvigtiavligivnlglniglhlkpscncsrsqpeatnasqtiinn
    yynetnitqisntniqveerasrefnnltkglctinswhiygkdnavrigedsdvlvtre
    pyvscdpdecrfyalsqgttirgkhsngtihdrsqyrdliswplsspptvynsrvecigw
    sstschdgrarmsicisgpnnnasaviwynrrpvteintwarnilrtqesecvcqngvcp
    vvftdgsatgpaetriyyfkegkilkwepltgtakhieecscygeqagvtctcrdnwqgs
    nrpviqidpvamthtsqyicspvltdnprpndptvgkcndpypgnnnngvkgfsyldggn
    twlgrtisiasrsgyemlkvpnaltddrskptqgqtivlntdwsgysgsfmdywaegecy
    racfyvelirgrpkedkvwwtsnsivsmcssteflgqwnwpdgakieyfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nmbN (N:)
    refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
    kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisiasrsgyemlkvpn
    altddrskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwnwpdgakieyfl