PDB entry 1nma

View 1nma on RCSB PDB site
Description: n9 neuraminidase complexes with antibodies nc41 and nc10: empirical free-energy calculations capture specificity trends observed with mutant binding data
Class: complex (hydrolase/immunoglobulin)
Keywords: COMPLEX (HYDROLASE-IMMUNOGLOBULIN), COMPLEX (HYDROLASE-IMMUNOGLOBULIN) complex
Deposited on 1994-05-06, released 1995-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab nc10
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA19165 (1-120)
      • conflict (6)
      • conflict (117)
    Domains in SCOPe 2.06: d1nmah_
  • Chain 'L':
    Compound: fab nc10
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA19165 (0-106)
      • conflict (2-3)
    Domains in SCOPe 2.06: d1nmal_
  • Chain 'N':
    Compound: n9 neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05803 (0-End)
      • conflict (305)
      • conflict (307)
    Domains in SCOPe 2.06: d1nman_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmaH (H:)
    evqlqqpgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
    nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttltv
    ss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmaL (L:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
    rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtkleirra
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1nmaN (N:)
    refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
    kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisiasrsgyemlkvpn
    altddksrptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwnwpdgakieyfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nmaN (N:)
    refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
    kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisiasrsgyemlkvpn
    altddksrptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwnw