PDB entry 1nm4

View 1nm4 on RCSB PDB site
Description: Solution structure of Cu(I)-CopC from Pseudomonas syringae
Class: metal binding protein
Keywords: copper trafficking, redox switch, Structural Proteomics in Europe, SPINE, Structural Genomics, METAL BINDING PROTEIN
Deposited on 2003-01-09, released 2003-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper resistance protein c
    Species: Pseudomonas syringae [TaxId:317]
    Gene: COPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1nm4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nm4A (A:)
hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk