PDB entry 1nm4

View 1nm4 on RCSB PDB site
Description: Solution structure of Cu(I)-CopC from Pseudomonas syringae
Class: metal binding protein
Keywords: copper trafficking, redox switch, Structural Proteomics in Europe, SPINE, Structural Genomics
Deposited on 2003-01-09, released 2003-04-08
The last revision prior to the SCOP 1.75 freeze date was dated 2004-01-13, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: copper resistance protein c
  Species: Pseudomonas syringae
  Gene: COPC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12376 (0-101)
  Domains in SCOP 1.75: d1nm4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nm4A (A:)
  hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
  gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk