PDB entry 1nm4

View 1nm4 on RCSB PDB site
Description: solution structure of cu(i)-copc from pseudomonas syringae
Deposited on 2003-01-09, released 2003-04-08
The last revision prior to the SCOP 1.71 freeze date was dated 2004-01-13, with a file datestamp of 2004-01-13.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1nm4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nm4A (A:)
  hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgg
  gdpktmvitpaspltagtykvdwravssdthpitgsvtfkvk