PDB entry 1nld

View 1nld on RCSB PDB site
Description: fab fragment of a neutralizing antibody directed against an epitope of gp41 from hiv-1
Deposited on 1996-07-02, released 1996-12-23
The last revision prior to the SCOP 1.59 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.198
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nldH (H:)
    qvklqqsgpglvqpsqslsitctvsgfsltcygvhwvrqspgkglewlgviwsggdtdyn
    aafisrlsitkdnsksqvffkmnslqpndraiyycarrggdfwgqgttvtvssasttaps
    vyplapvsgdqtnssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsss
    vtvtsspwpsetitcnvahpasstkvdkkieprgc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nldL (L:)
    dvvmtqtpltlsvtigqpasisckssqslldsdgktylnwllqrpgqspkrliylvskld
    sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec