PDB entry 1nl2

View 1nl2 on RCSB PDB site
Description: bovine prothrombin fragment 1 in complex with calcium and lysophosphotidylserine
Class: hydrolase
Keywords: hydrolase
Deposited on 2003-01-06, released 2003-09-16
The last revision prior to the SCOP 1.75 freeze date was dated 2003-09-16, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.236
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Prothrombin
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00735 (0-145)
    • modified residue (6-7)
    • modified residue (14)
    • modified residue (16)
    • modified residue (19-20)
    • modified residue (25-26)
    • modified residue (29)
    • modified residue (32)
  Domains in SCOP 1.75: d1nl2a1, d1nl2a2
• Heterogens: NAG, CA, CL, LPS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nl2A (A:)
  ankgfleevrkgnlerecleepcsreeafealeslsatdafwakytacesarnpreklne
  clegncaegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdg
  sitgpwcyttsptlrreecsvpvcgq