PDB entry 1nkr

View 1nkr on RCSB PDB site
Description:
Deposited on 1998-06-24, released 1998-11-11
The last revision prior to the SCOP 1.69 freeze date was dated 1998-11-11, with a file datestamp of 1998-11-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.205
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1nkr_1, d1nkr_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1nkr_ (-)
    mhegvhrkpsllahpgplvkseetvilqcwsdvmfehfllhregmfndtlrligehhdgv
    skanfsisrmtqdlagtyrcygsvthspyqvsapsdpldiviiglyekpslsaqpgptvl
    agenvtlscssrssydmyhlsregeaherrlpagpkvngtfqadfplgpathggtyrcfg
    sfhdspyewskssdpllvsvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkr_ (-)
    rkpsllahpgplvkseetvilqcwsdvmfehfllhregmfndtlrligehhdgvskanfs
    isrmtqdlagtyrcygsvthspyqvsapsdpldiviiglyekpslsaqpgptvlagenvt
    lscssrssydmyhlsregeaherrlpagpkvngtfqadfplgpathggtyrcfgsfhdsp
    yewskssdpllvsvt