PDB entry 1nkq

View 1nkq on RCSB PDB site
Description: Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
Class: Structural Genomics, Unknown Function
Keywords: dimer, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, Structural Genomics, Unknown Function
Deposited on 2003-01-03, released 2004-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 28.8 kDa protein in PSD1-SKO1 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YNL168C or N1696
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53889
      • modified residue (103)
      • modified residue (147)
      • modified residue (188)
      • modified residue (202)
      • modified residue (242)
    Domains in SCOPe 2.07: d1nkqa_
  • Chain 'B':
    Compound: Hypothetical 28.8 kDa protein in PSD1-SKO1 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YNL168C or N1696
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53889
      • modified residue (103)
      • modified residue (147)
      • modified residue (188)
      • modified residue (202)
      • modified residue (242)
    Domains in SCOPe 2.07: d1nkqb_
  • Chain 'C':
    Compound: Hypothetical 28.8 kDa protein in PSD1-SKO1 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YNL168C or N1696
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53889
      • modified residue (103)
      • modified residue (147)
      • modified residue (188)
      • modified residue (202)
      • modified residue (242)
    Domains in SCOPe 2.07: d1nkqc_
  • Chain 'D':
    Compound: Hypothetical 28.8 kDa protein in PSD1-SKO1 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YNL168C or N1696
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53889
      • modified residue (103)
      • modified residue (147)
      • modified residue (188)
      • modified residue (202)
      • modified residue (242)
    Domains in SCOPe 2.07: d1nkqd_
  • Chain 'E':
    Compound: Hypothetical 28.8 kDa protein in PSD1-SKO1 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YNL168C or N1696
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53889
      • modified residue (103)
      • modified residue (147)
      • modified residue (188)
      • modified residue (202)
      • modified residue (242)
    Domains in SCOPe 2.07: d1nkqe_
  • Chain 'F':
    Compound: Hypothetical 28.8 kDa protein in PSD1-SKO1 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YNL168C or N1696
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53889
      • modified residue (103)
      • modified residue (147)
      • modified residue (188)
      • modified residue (202)
      • modified residue (242)
    Domains in SCOPe 2.07: d1nkqf_
  • Heterogens: CA, SO4, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nkqA (A:)
    msynylkaarkiicigrnyaahikelnnstpkqpffflkptssivtplssslvkttrpan
    stfnglnedgtnpgpifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalal
    dltarnvqdeakkkglpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngql
    rqdggtnlmlhplhkilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndni
    vdmnfecenrpgpyefret
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkqA (A:)
    synylkaarkiicigrnyaahikelnnqpffflkptssivtplssspanstfnglnedgt
    npgpifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalaldltarnvqdea
    kkkglpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngqlrqdggtnlmlh
    plhkilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndnivdmnfecenrp
    gpyefre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nkqB (B:)
    msynylkaarkiicigrnyaahikelnnstpkqpffflkptssivtplssslvkttrpan
    stfnglnedgtnpgpifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalal
    dltarnvqdeakkkglpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngql
    rqdggtnlmlhplhkilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndni
    vdmnfecenrpgpyefret
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkqB (B:)
    synylkaarkiicigrnyaahikelqpffflkptssivtplsspanstfnglnedgtnpg
    pifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalaldltarnvqdeakkk
    glpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngqlrqdggtnlmlhplh
    kilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndnivdmnfecenrpgpy
    efre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nkqC (C:)
    msynylkaarkiicigrnyaahikelnnstpkqpffflkptssivtplssslvkttrpan
    stfnglnedgtnpgpifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalal
    dltarnvqdeakkkglpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngql
    rqdggtnlmlhplhkilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndni
    vdmnfecenrpgpyefret
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkqC (C:)
    synylkaarkiicigrnyaahikelqpffflkptssivtplssspanstfnglnedgtnp
    gpifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalaldltarnvqdeakk
    kglpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngqlrqdggtnlmlhpl
    hkilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndnivdmnfecenrpgp
    yefre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nkqD (D:)
    msynylkaarkiicigrnyaahikelnnstpkqpffflkptssivtplssslvkttrpan
    stfnglnedgtnpgpifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalal
    dltarnvqdeakkkglpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngql
    rqdggtnlmlhplhkilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndni
    vdmnfecenrpgpyefret
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkqD (D:)
    synylkaarkiicigrnyaahikelqpffflkptssivtplsspanstfnglnedgtnpg
    pifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalaldltarnvqdeakkk
    glpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngqlrqdggtnlmlhplh
    kilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndnivdmnfecenrpgpy
    efre
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nkqE (E:)
    msynylkaarkiicigrnyaahikelnnstpkqpffflkptssivtplssslvkttrpan
    stfnglnedgtnpgpifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalal
    dltarnvqdeakkkglpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngql
    rqdggtnlmlhplhkilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndni
    vdmnfecenrpgpyefret
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkqE (E:)
    synylkaarkiicigrnyaahikelnnqpffflkptssivtplssspanstfnglnedgt
    npgpifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalaldltarnvqdea
    kkkglpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngqlrqdggtnlmlh
    plhkilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndnivdmnfecenrp
    gpyefr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1nkqF (F:)
    msynylkaarkiicigrnyaahikelnnstpkqpffflkptssivtplssslvkttrpan
    stfnglnedgtnpgpifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalal
    dltarnvqdeakkkglpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngql
    rqdggtnlmlhplhkilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndni
    vdmnfecenrpgpyefret
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkqF (F:)
    synylkaarkiicigrnyaahqpffflkptssivtplsspanstfnglnedgtnpgpifi
    prgvkvhheielalivskhlsnvtkmkpeevydsisgvalaldltarnvqdeakkkglpw
    tiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngqlrqdggtnlmlhplhkilq
    histmislepgdiiltgtpagvgelkpgdrvhcellqnndnivdmnfecenrpgpyefre