PDB entry 1nkh

View 1nkh on RCSB PDB site
Description: Crystal structure of Lactose synthase complex with UDP and Manganese
Class: transferase activator/transferase
Keywords: lactose synthease, UDP and MN binding, TRANSFERASE ACTIVATOR/TRANSFERASE COMPLEX
Deposited on 2003-01-03, released 2003-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lactalbumin
    Species: Mus musculus [TaxId:10090]
    Gene: alpha-lactalbumin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nkha_
  • Chain 'B':
    Compound: beta-1,4-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Gene: beta1,4-galactosyltransferase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nkhb_
  • Chain 'C':
    Compound: alpha-lactalbumin
    Species: Mus musculus [TaxId:10090]
    Gene: alpha-lactalbumin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nkhc_
  • Chain 'D':
    Compound: beta-1,4-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Gene: beta1,4-galactosyltransferase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nkhd_
  • Heterogens: CA, MN, SO4, UDP, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkhA (A:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nkhB (B:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkhB (B:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkhC (C:)
    teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
    ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
    ekp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nkhD (D:)
    asmtggqqmgrgssltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdc
    isphkvaiiipfrnrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgf
    kealkdydyncfvfsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsal
    skqqflsingfpnnywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepn
    pqrfdriahtketmlsdglnsltymvlevqryplytkitvdigtps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nkhD (D:)
    ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
    rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
    sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
    ywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketm
    lsdglnsltymvlevqryplytkitvdigtps