PDB entry 1njw

View 1njw on RCSB PDB site
Description: guanine-thymine mismatch at the polymerase active site
Class: transferase/DNA
Keywords: DNA polymerase I, DNA replication, klenow fragment, protein-DNA complex, DNA mismatch, transferase/DNA complex
Deposited on 2003-01-02, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase I
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NJW (0-579)
    Domains in SCOPe 2.07: d1njwa1, d1njwa2
  • Chain 'B':
    Compound: DNA primer strand
  • Chain 'C':
    Compound: DNA template strand
  • Heterogens: SUC, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1njwA (A:)
    akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
    fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
    kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrneqdrllve
    leqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefninspkqlgv
    ilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyiegllkvvr
    pdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwlifaadysq
    ielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakavnfgivygi
    sdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllhrrrylpdi
    tsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqvhdelilea
    pkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.