PDB entry 1nj3

View 1nj3 on RCSB PDB site
Description: structure and ubiquitin interactions of the conserved nzf domain of npl4
Deposited on 2002-12-30, released 2003-04-22
The last revision prior to the SCOP 1.67 freeze date was dated 2003-04-22, with a file datestamp of 2003-04-22.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nj3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nj3A (A:)
    gstsamwacqhctfmnqpgtghcemcslprt