PDB entry 1nhj

View 1nhj on RCSB PDB site
Description: crystal structure of n-terminal 40kd mutl/a100p mutant protein complex with adpnp and one sodium
Deposited on 2002-12-19, released 2003-06-10
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-10, with a file datestamp of 2003-06-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhjA (A:)
    shmpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirird
    ngcgikkdelalalarhatskiaslddleaiislgfrgealpsissvsrltltsrtaeqq
    eawqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirri
    alarfdvtinlshngkivrqyravpeggqkerrlgaicgtafleqalaiewqhgdltlrg
    wvadpnhttpalaeiqycyvngrmmrdrlinhairqacedklgadqqpafvlyleidphq
    vdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq