PDB entry 1nhi

View 1nhi on RCSB PDB site
Description: Crystal structure of N-terminal 40KD MutL (LN40) complex with ADPnP and one potassium
Deposited on 2002-12-19, released 2003-06-10
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-10, with a file datestamp of 2003-06-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhiA (A:)
    shmpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirird
    ngcgikkdelalalarhatskiaslddleaiislgfrgealasissvsrltltsrtaeqq
    eawqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirri
    alarfdvtinlshngkivrqyravpeggqkerrlgaicgtafleqalaiewqhgdltlrg
    wvadpnhttpalaeiqycyvngrmmrdrlinhairqacedklgadqqpafvlyleidphq
    vdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq