PDB entry 1nhh

View 1nhh on RCSB PDB site
Description: Crystal structure of N-terminal 40KD MutL protein (LN40) complex with ADPnP and one Rubidium
Deposited on 2002-12-19, released 2003-06-10
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-10, with a file datestamp of 2003-06-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nhhA (A:)
    shmpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirird
    ngcgikkdelalalarhatskiaslddleaiislgfrgealasissvsrltltsrtaeqq
    eawqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirri
    alarfdvtinlshngkivrqyravpeggqkerrlgaicgtafleqalaiewqhgdltlrg
    wvadpnhttpalaeiqycyvngrmmrdrlinhairqacedklgadqqpafvlyleidphq
    vdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nhhA (A:)
    shmpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirird
    ngcgikkdelalalarhatskiaslddleaiislgfrgealasissvsrltltsrtaeqq
    eawqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirri
    alarfdvtinlshngkivrqyravpqkerrlgaicgtafleqalaiewqhgdltlrgwva
    dpnhttpalaeiqycyvngrmmrdrlinhairqacedklgqqpafvlyleidphqvdvnv
    hpakhevrfhqsrlvhdfiyqgvlsvlq