PDB entry 1nha

View 1nha on RCSB PDB site
Description: Solution Structure of the Carboxyl-Terminal Domain of RAP74 and NMR Characterization of the FCP-Binding Sites of RAP74 and CTD of RAP74, the subunit of Human TFIIF
Class: transcription
Keywords: transcription factor, human general transcription factor tfiif, rap74
Deposited on 2002-12-19, released 2003-02-25
The last revision prior to the SCOP 1.73 freeze date was dated 2003-02-25, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription initiation factor iif, alpha subunit
    Species: HOMO SAPIENS
    Gene: RAP74
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1nhaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1nhaA (A:)
stpqppsgkttpnsgdvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaq
ilkrlnperkmindkmhfslke

    Sequence, based on observed residues (ATOM records): (download) 
    >1nhaA (A:)
dvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnperkmindk
mhfslke