PDB entry 1nha

View 1nha on RCSB PDB site
Description: solution structure of the carboxyl-terminal domain of rap74 and nmr characterization of the fcp-binding sites of rap74 and ctd of rap74, the subunit of human tfiif
Deposited on 2002-12-19, released 2003-02-25
The last revision prior to the SCOP 1.71 freeze date was dated 2003-02-25, with a file datestamp of 2003-02-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1nhaa_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1nhaA (A:)
  stpqppsgkttpnsgdvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaq
  ilkrlnperkmindkmhfslke
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1nhaA (A:)
  dvqvtedavrryltrkpmttkdllkkfqtkktglsseqtvnvlaqilkrlnperkmindk
  mhfslke