PDB entry 1nh4

View 1nh4 on RCSB PDB site
Description: Structure of the coat protein in fd filamentous bacteriophage particles
Class: Virus
Keywords: ALPHA HELIX, Helical virus
Deposited on 2002-12-18, released 2003-05-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: SOLID-STATENMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major coat protein
    Species: Enterobacteria phage fd [TaxId:10864]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nh4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nh4A (A:)
    aegddpakaafdslqasatemigyawamvvvivgatigiklfkkftskas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nh4A (A:)
    pakaafdslqasatemigyawamvvvivgatigiklfkkftska