PDB entry 1ngv

View 1ngv on RCSB PDB site
Description: Insights into the ubiquitin transfer cascade from the structure of the E1 for NEDD8.
Deposited on 2002-12-17, released 2003-03-25
The last revision prior to the SCOP 1.65 freeze date was dated 2003-03-25, with a file datestamp of 2003-03-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ngva_
  • Chain 'B':
    Domains in SCOP 1.65: d1ngvb_
  • Chain 'C':
    Domains in SCOP 1.65: d1ngvc_
  • Chain 'D':
    Domains in SCOP 1.65: d1ngvd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ngvA (A:)
    maqlgkllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftii
    dgnqvsgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsff
    crftvvvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnal
    edlrldkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykek
    edfrdlirqgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkq
    tpsfwilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnh
    vakllqsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpd
    neivlylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvh
    efcrygaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngvA (A:)
    kllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqv
    sgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftv
    vvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrl
    dkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrd
    lirqgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfw
    ilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakll
    qsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivl
    ylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcry
    gaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ngvB (B:)
    mavdggcgdtgdwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglg
    cellknlalsgfrqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnv
    vphfnkiqdfndtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidg
    gtegfkgnarvilpgmtaciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpke
    qpfgegvpldgddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnavia
    avcatevfkiatsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsak
    lqevldyltnsaslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdg
    qelavadvttpqtvlfklhfts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngvB (B:)
    dwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsg
    frqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfn
    dtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarv
    ilpgmtaciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpkeqpfgegvpldg
    ddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkia
    tsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqlqevldyltnsaslqmk
    spaitatrtlylqseertrpnladvttpqtvlfklhft
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ngvC (C:)
    maqlgkllkeqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftii
    dgnqvsgedagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsff
    crftvvvatqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnal
    edlrldkpfpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykek
    edfrdlirqgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkq
    tpsfwilaralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnh
    vakllqsigqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpd
    neivlylmlravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvh
    efcrygaaephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngvC (C:)
    keqkydrqlrlwgdhgqealesahvclinatatgteilknlvlpgigsftiidgnqvsge
    dagnnfflqrssigknraeaameflqelnsdvsgsfveespenlldndpsffcrftvvva
    tqlpestslrladvlwnsqipllicrtyglvgymriiikehpvieshpdnaledlrldkp
    fpelrehfqsydldhmekkdhshtpwiviiakylaqwysetngripktykekedfrdlir
    qgilknengapedeenfeeaiknvntalnttqipssiedifnddrcinitkqtpsfwila
    ralkefvakegqgnlpvrgtipdmiadsgkyiklqnvyrekakkdaaavgnhvakllqsi
    gqapesisekelkllcsnsaflrvvrcrslaeeygldtinkdeiissmdnpdneivlylm
    lravdrfhkqqgrypgvsnyqveedigklkscltgflqeyglsvmvkddyvhefcrygaa
    ephtiaaflggaaaqevikiitkqfvifnntyiysgmsqtsatfql
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ngvD (D:)
    mavdggcgdtgdwegrwnhvkkflersgpfthpdfepsteslqflldtckvlvigagglg
    cellknlalsgfrqihvidmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnv
    vphfnkiqdfndtfyrqfhiivcgldsiiarrwingmlisllnyedgvldpssivplidg
    gtegfkgnarvilpgmtaciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpke
    qpfgegvpldgddpehiqwifqkslerasqynirgvtyrltqgvvkriipavastnavia
    avcatevfkiatsayiplnnylvfndvdglytytfeaerkencpacsqlpqniqfspsak
    lqevldyltnsaslqmkspaitatlegknrtlylqsvtsieertrpnlsktlkelglvdg
    qelavadvttpqtvlfklhfts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngvD (D:)
    hvkkflersgpfthpdfepsteslqflldtckvlvigagglgcellknlalsgfrqihvi
    dmdtidvsnlnrqflfrpkdigrpkaevaaeflndrvpncnvvphfnkiqdfndtfyrqf
    hiivcgldsiiarrwingmlisllnyedgvldpssivplidggtegfkgnarvilpgmta
    ciectlelyppqvnfpmctiasmprlpehcieyvrmlqwpkeqpfgegvpldgddpehiq
    wifqkslerasqynirgvtyrltqgvvkriipavastnaviaavcatevfkiatsayipl
    nnylvfndvdglytytfeaerkencpacsqlpqniqlqevldyltnsaslqmkspaitnr
    tlylqsveertradvttpqtvlfklhf