PDB entry 1ngs

View 1ngs on RCSB PDB site
Description: complex of transketolase with thiamin diphosphate, ca2+ and acceptor substrate erythrose-4-phosphate
Class: transferase
Keywords: transferase, thiamine pyrophosphate, magnesium, multigene family
Deposited on 1996-09-25, released 1997-02-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ngsa1, d1ngsa2, d1ngsa3
  • Chain 'B':
    Compound: transketolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ngsb1, d1ngsb2, d1ngsb3
  • Heterogens: CA, E4P, TPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ngsA (A:)
    mtqftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinr
    drfvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgq
    gisnavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnl
    iaiyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdk
    ptlikmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqkt
    ilkpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrk
    lsetvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygireha
    mgaimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpt
    hqpietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssie
    saskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqple
    yrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaera
    qktiafykgdklisplkkaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngsA (A:)
    qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
    fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
    snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
    iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
    likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
    kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
    etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
    aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
    pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
    skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
    lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
    tiafykgdklisplkkaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ngsB (B:)
    mtqftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinr
    drfvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgq
    gisnavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnl
    iaiyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdk
    ptlikmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqkt
    ilkpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrk
    lsetvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygireha
    mgaimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpt
    hqpietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssie
    saskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqple
    yrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaera
    qktiafykgdklisplkkaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngsB (B:)
    qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
    fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
    snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
    iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
    likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
    kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
    etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
    aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
    pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
    skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
    lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
    tiafykgdklisplkkaf