PDB entry 1nfk

View 1nfk on RCSB PDB site
Description: structure of the nuclear factor kappa-b (nf-kb) p50 homodimer
Deposited on 1995-02-28, released 1996-12-23
The last revision prior to the SCOP 1.63 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfkA (A:)
    gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
    tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
    cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
    pdstgsftrrlepvvsdaiydskapnasnlkivrmdrtagcvtggeeiyllcdkvqkddi
    qirfyeeeenggvwegfgdfsptdvhrqfaivfktpkykdvnitkpasvfvqlrrksdle
    tsepkpflyype
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfkB (B:)
    gpylqileqpkqrgfrfryvcegpshgglpgasseknkksypqvkicnyvgpakvivqlv
    tngknihlhahslvgkhcedgvctvtagpkdmvvgfanlgilhvtkkkvfetlearmtea
    cirgynpgllvhsdlaylqaegggdrqltdrekeiirqaavqqtkemdlsvvrlmftafl
    pdstgsftrrlepvvsdaiydskapnasnlkivrmdrtagcvtggeeiyllcdkvqkddi
    qirfyeeeenggvwegfgdfsptdvhrqfaivfktpkykdvnitkpasvfvqlrrksdle
    tsepkpflyype