PDB entry 1nfi

View 1nfi on RCSB PDB site
Description: i-kappa-b-alpha/nf-kappa-b complex
Deposited on 1998-08-25, released 1998-11-18
The last revision prior to the SCOP 1.63 freeze date was dated 1999-02-23, with a file datestamp of 1999-02-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.223
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfiA (A:)
    yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk
    dpphrphphelvgkdcrdgfyeaelcpdrcihsfqnlgiqcvkkrdleqaisqriqtnnn
    pfqvpieeqrgdydlnavrlcfqvtvrdpsgrplrlppvlphpifdnrapntaelkicrv
    nrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaivfrtppyad
    pslqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrkrtyetfksimk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfiB (B:)
    snlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhr
    qfaivfktpkykdinitkpasvfvqlrrksdletsepkpflyypeik
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfiC (C:)
    yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk
    dpphrphphelvgkdcrdgfyeaelcpdrcihsfqnlgiqcvkkrdleqaisqriqtnnn
    pfqvpieeqrgdydlnavrlcfqvtvrdpsgrplrlppvlphpifdnrapntaelkicrv
    nrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaivfrtppyad
    pslqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrkrtyetfksimkkspfs
    g
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfiD (D:)
    snlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhr
    qfaivfktpkykdinitkpasvfvqlrrksdletsepkpflyypeik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nfiE (E:)
    ltedgdsflhlaiiheekaltmevirqvkgdlaflnfqnnlqqtplhlavitnqpeiaea
    llgagcdpelrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhl
    asihgylgivellvslcadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyn
    gyspyqltwgrpstriqqqlgqltlenlqmlpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfiE (E:)
    ltedgdsflhlaiiheekaltmevirqvkgdlaflnfqnnlqqtplhlavitnqpeiaea
    llgagcdpelrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhl
    asihgylgivellvslgadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyq
    gyspyqltwgrpstriqqqlgqltlenlqmlpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1nfiF (F:)
    ltedgdsflhlaiiheekaltmevirqvkgdlaflnfqnnlqqtplhlavitnqpeiaea
    llgagcdpelrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhl
    asihgylgivellvslcadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyn
    gyspyqltwgrpstriqqqlgqltlenlqmlpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nfiF (F:)
    ltedgdsflhlaiiheekaltmevirqvkgdlaflnfqnnlqqtplhlavitnqpeiaea
    llgagcdpelrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhl
    asihgylgivellvslgadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyq
    gyspyqltwgrpstriqqqlgqltlenlqmlpe