PDB entry 1nfd

View 1nfd on RCSB PDB site
Description:
Deposited on 1997-08-04, released 1998-01-28
The last revision prior to the SCOP 1.61 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.243
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1nfda1, d1nfda2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1nfdb1, d1nfdb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1nfdc1, d1nfdc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1nfdd1, d1nfdd2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1nfde1, d1nfde2
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1nfdf1, d1nfdf2
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1nfdg1, d1nfdg2
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1nfdh1, d1nfdh2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdA (A:)
    dsvtqteglvtvteglpvklnctyqttyltiaffwyvqylneapqvllksstdnkrtehq
    gfhatlhkssssfhlqkssaqlsdsalyycalseggnykyvfgagtrlkviahiqnpepa
    vyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksngaiawsnq
    tsftcqdifketnatypssdvpc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdB (B:)
    dsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgfl
    psrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvledlrnvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdC (C:)
    dsvtqteglvtvteglpvklnctyqttyltiaffwyvqylneapqvllksstdnkrtehq
    gfhatlhkssssfhlqkssaqlsdsalyycalseggnykyvfgagtrlkviahiqnpepa
    vyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksngaiawsnq
    tsftcqdifketnatypssdvpc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdD (D:)
    dsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgfl
    psrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvledlrnvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syslssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradc
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdE (E:)
    yeliqpssasvtvgetvkitcsgdqlpknfaywfqqksdknillliymdnkrpsgiperf
    sgstsgttatltisgaqpedeaayyclssygdnndlvfgsgtqltvlrgpksspkvtvfp
    pspeelrtnkatlvclvndfypgsatvtwkangatindgvkttkpskqgqnymtssylsl
    tadqwkshnrvscqvthegetvekslspaecl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdF (F:)
    evylvesggdlvqpgsslkvscaasgftfsdfwmywvrqapgkglewvgriknipnnyat
    eyadsvrgrftisrddsrnsiylqmnrlrvddtaiyyctragrfdhfdywgqgtmvtvss
    atttapsvyplapacdsttsttdtvtlgclvkgyfpepvtvswnsgaltsgvhtfpsvlh
    sglyslsssvtvpsstwpkqpitcnvahpasstkvdkkiepr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdG (G:)
    yeliqpssasvtvgetvkitcsgdqlpknfaywfqqksdknillliymdnkrpsgiperf
    sgstsgttatltisgaqpedeaayyclssygdnndlvfgsgtqltvlrgpksspkvtvfp
    pspeelrtnkatlvclvndfypgsatvtwkangatindgvkttkpskqgqnymtssylsl
    tadqwkshnrvscqvthegetvekslspaecl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nfdH (H:)
    evylvesggdlvqpgsslkvscaasgftfsdfwmywvrqapgkglewvgriknipnnyat
    eyadsvrgrftisrddsrnsiylqmnrlrvddtaiyyctragrfdhfdywgqgtmvtvss
    atttapsvyplapacdsttsttdtvtlgclvkgyfpepvtvswnsgaltsgvhtfpsvlh
    sglyslsssvtvpsstwpkqpitcnvahpasstkvdkkiepr