PDB entry 1nez

View 1nez on RCSB PDB site
Description: The Crystal Structure of a TL/CD8aa Complex at 2.1A resolution:Implications for Memory T cell Generation, Co-receptor Preference and Affinity
Class: immune system
Keywords: immune system
Deposited on 2002-12-12, released 2003-04-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, TLA(C) alpha chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1neza1, d1neza2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1nezb_
  • Chain 'G':
    Compound: T-cell surface glycoprotein CD8 alpha chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01731 (Start-121)
      • cloning artifact (122-124)
    Domains in SCOPe 2.02: d1nezg_
  • Chain 'H':
    Compound: T-cell surface glycoprotein CD8 alpha chain
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1nezh_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nezA (A:)
    gshslryfytalsrpaisepwyiavgylddtqfarfdsagetgtyklsapwveqegpeyw
    areteivtsnaqffrenlqtmldyynlsqngshtiqvmygceveffgslfrayeqhgydg
    qdyialnedlktwtaadmaaeitrskweqagytelrrtylegpckdsllrylenrkktqe
    ctdppkthvthharpegdvtlrcwalgfypahitltwqlngeeliqdtelvetrpagdgt
    fqkwaavvvpsgeeqkytchvyheglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nezB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1nezG (G:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
    kvssalvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nezG (G:)
    apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
    twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvs
    sa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1nezH (H:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
    kvssalvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nezH (H:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq