PDB entry 1nex

View 1nex on RCSB PDB site
Description: crystal structure of scskp1-sccdc4-cpd peptide complex
Deposited on 2002-12-12, released 2003-02-18
The last revision prior to the SCOP 1.69 freeze date was dated 2003-02-18, with a file datestamp of 2003-02-18.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.239
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nexA (A:)
    gahmvtsnvvlvsgegerftvdkkiaerslllknylndmgddddedddeivmpvpnvrss
    vlqkviewaehhrdsnfpdeddddsrksapvdswdreflkvdqemlyeiilaanylnikp
    lldagckvvaemirgrspeeirrtfnivndftpeeeaairrenewaedr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nexA (A:)
    snvvlvsgegerftvdkkiaerslllknylivmpvpnvrssvlqkviewaehhrdsnfpv
    dswdreflkvdqemlyeiilaanylnikplldagckvvaemirgrspeeirrtfnivndf
    tpeeeaair
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nexB (B:)
    gagtlikdnlkrdlitslpfeislkifnylqfediinslgvsqnwnkiirkstslwkkll
    isenfvspkgfnslnlklsqkypklsqqdrlrlsflenifilknwynpkfvpqrttlrgh
    mtsvitclqfednyvitgaddkmirvydsinkkfllqlsghdggvwalkyahggilvsgs
    tdrtvrvwdikkgccthvfeghnstvrcldiveyknikyivtgsrdntlhvwklpkessv
    pdhgeehdyplvfhtpeenpyfvgvlrghmasvrtvsghgnivvsgsydntlivwdvaqm
    kclyilsghtdriystiydherkrcisasmdttiriwdlengelmytlqghtalvgllrl
    sdkflvsaaadgsirgwdandysrkfsyhhtnlsaittfyvsdnilvsgsenqfniynlr
    sgklvhanilkdadqiwsvnfkgktlvaavekdgqsfleildfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nexB (B:)
    lkrdlitslpfeislkifnylqfediinslgvsqnwnkiirkstslwkkllisenfvspk
    gfnslnlklsqkypklsqqdrlrlsflenifilknwynpkfvpqrttlrghmtsvitclq
    fednyvitgaddkmirvydsinkkfllqlsghdggvwalkyahggilvsgstdrtvrvwd
    ikkgccthvfeghnstvrcldiveyknikyivtgsrdntlhvwklpkdyplvfhtpeenp
    yfvgvlrghmasvrtvsghgnivvsgsydntlivwdvaqmkclyilsghtdriystiydh
    erkrcisasmdttiriwdlengelmytlqghtalvgllrlsdkflvsaaadgsirgwdan
    dysrkfsyhhtnlsaittfyvsdnilvsgsenqfniynlrsgklvhanilkdadqiwsvn
    fkgktlvaavekdgqsfleildfs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nexC (C:)
    gahmvtsnvvlvsgegerftvdkkiaerslllknylndmgddddedddeivmpvpnvrss
    vlqkviewaehhrdsnfpdeddddsrksapvdswdreflkvdqemlyeiilaanylnikp
    lldagckvvaemirgrspeeirrtfnivndftpeeeaairrenewaedr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nexC (C:)
    snvvlvsgegerftvdkkiaerslllknylivmpvpnvrssvlqkviewaehhrdsnfpv
    dswdreflkvdqemlyeiilaanylnikplldagckvvaemirgrspeeirrtfnivndf
    tpeeeaairr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nexD (D:)
    gagtlikdnlkrdlitslpfeislkifnylqfediinslgvsqnwnkiirkstslwkkll
    isenfvspkgfnslnlklsqkypklsqqdrlrlsflenifilknwynpkfvpqrttlrgh
    mtsvitclqfednyvitgaddkmirvydsinkkfllqlsghdggvwalkyahggilvsgs
    tdrtvrvwdikkgccthvfeghnstvrcldiveyknikyivtgsrdntlhvwklpkessv
    pdhgeehdyplvfhtpeenpyfvgvlrghmasvrtvsghgnivvsgsydntlivwdvaqm
    kclyilsghtdriystiydherkrcisasmdttiriwdlengelmytlqghtalvgllrl
    sdkflvsaaadgsirgwdandysrkfsyhhtnlsaittfyvsdnilvsgsenqfniynlr
    sgklvhanilkdadqiwsvnfkgktlvaavekdgqsfleildfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nexD (D:)
    lkrdlitslpfeislkifnylqfediinslgvsqnwnkiirkstslwkkllisenfvspk
    gfnslnlklsqkypklsqqdrlrlsflenifilknwynpkfvpqrttlrghmtsvitclq
    fednyvitgaddkmirvydsinkkfllqlsghdggvwalkyahggilvsgstdrtvrvwd
    ikkgccthvfeghnstvrcldiveyknikyivtgsrdntlhvwklpkdyplvfhtpeenp
    yfvgvlrghmasvrtvsghgnivvsgsydntlivwdvaqmkclyilsghtdriystiydh
    erkrcisasmdttiriwdlengelmytlqghtalvgllrlsdkflvsaaadgsirgwdan
    dysrkfsyhhtnlsaittfyvsdnilvsgsenqfniynlrsgklvhanilkdadqiwsvn
    fkgktlvaavekdgqsfleildfs