PDB entry 1neu

View 1neu on RCSB PDB site
Description: structure of myelin membrane adhesion molecule p0
Deposited on 1996-09-24, released 1997-05-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1neu__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1neu_ (-)
    ivvytdrevygavgsqvtlhcsfwssewvsddisftwryqpeggrdaisifhyakgqpyi
    devgtfkeriqwvgdpswkdgsivihnldysdngtftcdvknppdivgktsqvtlyvfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1neu_ (-)
    ivvytdrevygavgsqvtlhcsfwssewvsddisftwryqpeggrdaisifhyakgqpyi
    devgtfkeriqwvgdpswkdgsivihnldysdngtftcdvknvgktsqvtlyvfe