PDB entry 1neq

View 1neq on RCSB PDB site
Description: solution structure of the mu ner protein by multidimensional nmr
Deposited on 1995-08-24, released 1995-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1neq__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1neq_ (-)
  csnekardwhradviaglkkrklslsalsrqfgyapttlanalerhwpkgeqiianalet
  kpeviwpsryqage