PDB entry 1nep

View 1nep on RCSB PDB site
Description: Crystal Structure Analysis of the Bovine NPC2 (Niemann-Pick C2) Protein
Class: lipid binding protein
Keywords: NPC2, bNPC2, Niemann-Pick C2, LDL, cholesterol, LIPID BINDING PROTEIN
Deposited on 2002-12-11, released 2003-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.195
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Epididymal secretory protein E1
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P79345 (0-129)
  Domains in SCOPe 2.07: d1nepa_
• Heterogens: NAG, PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nepA (A:)
  epvkfkdcgswvgvikevnvspcptqpcklhrgqsysvnvtftsntqsqsskavvhgivm
  gipvpfpipesdgcksgircpiekdktynyvnklpvkneypsikvvveweltddknqrff
  cwqipievea