PDB entry 1nep

View 1nep on RCSB PDB site
Description: Crystal Structure Analysis of the Bovine NPC2 (Niemann-Pick C2) Protein
Class: lipid binding protein
Keywords: NPC2, bNPC2, Niemann-Pick C2, LDL, cholesterol, LIPID BINDING PROTEIN
Deposited on 2002-12-11, released 2003-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epididymal secretory protein E1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nepa_
  • Heterogens: NAG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nepA (A:)
    epvkfkdcgswvgvikevnvspcptqpcklhrgqsysvnvtftsntqsqsskavvhgivm
    gipvpfpipesdgcksgircpiekdktynyvnklpvkneypsikvvveweltddknqrff
    cwqipievea