PDB entry 1ndo

View 1ndo on RCSB PDB site
Description: napthalene 1,2-dioxygenase
Class: non-heme iron dioxygenase
Keywords: non-heme iron dioxygenase
Deposited on 1998-01-11, released 1999-03-23
The last revision prior to the SCOP 1.73 freeze date was dated 1999-03-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.22
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: napthalene 1,2-dioxygenase
    Species: Pseudomonas putida
    Gene: NAHACAD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ndoa1, d1ndoa2
  • Chain 'B':
    Compound: napthalene 1,2-dioxygenase
    Species: Pseudomonas putida
    Gene: NAHACAD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ndob_
  • Chain 'C':
    Compound: napthalene 1,2-dioxygenase
    Species: Pseudomonas putida
    Gene: NAHACAD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ndoc1, d1ndoc2
  • Chain 'D':
    Compound: napthalene 1,2-dioxygenase
    Species: Pseudomonas putida
    Gene: NAHACAD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ndod_
  • Chain 'E':
    Compound: napthalene 1,2-dioxygenase
    Species: Pseudomonas putida
    Gene: NAHACAD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ndoe1, d1ndoe2
  • Chain 'F':
    Compound: napthalene 1,2-dioxygenase
    Species: Pseudomonas putida
    Gene: NAHACAD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ndof_
  • Heterogens: FE, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ndoA (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkttdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ndoA (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltktt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ndoB (B:)
    mminiqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgs
    evqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfi
    tnvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdy
    perilqthnlmvfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ndoB (B:)
    miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
    vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
    nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
    erilqthnlmvfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ndoC (C:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkttdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ndoC (C:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltktt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ndoD (D:)
    mminiqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgs
    evqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfi
    tnvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdy
    perilqthnlmvfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ndoD (D:)
    miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
    vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
    nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
    erilqthnlmvfl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ndoE (E:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkttdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ndoE (E:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ndoF (F:)
    mminiqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgs
    evqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfi
    tnvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdy
    perilqthnlmvfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ndoF (F:)
    miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
    vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
    nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
    erilqthnlmvfl