PDB entry 1nd6

View 1nd6 on RCSB PDB site
Description: Crystal Structures of Human Prostatic Acid Phosphatase in Complex with a Phosphate Ion and alpha-Benzylaminobenzylphosphonic Acid Update the Mechanistic Picture and Offer New Insights into Inhibitor Design
Deposited on 2002-12-07, released 2002-12-20
The last revision prior to the SCOP 1.71 freeze date was dated 2003-05-06, with a file datestamp of 2003-05-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1nd6a_
  • Chain 'B':
    Domains in SCOP 1.71: d1nd6b_
  • Chain 'C':
    Domains in SCOP 1.71: d1nd6c_
  • Chain 'D':
    Domains in SCOP 1.71: d1nd6d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nd6A (A:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmttnshqgtedstd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nd6A (A:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nd6B (B:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmttnshqgtedstd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nd6B (B:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmtt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nd6C (C:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmttnshqgtedstd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nd6C (C:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nd6D (D:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmttnshqgtedstd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nd6D (D:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt