PDB entry 1nd5

View 1nd5 on RCSB PDB site
Description: Crystal Structures of Human Prostatic Acid Phosphatase in Complex with a Phosphate Ion and alpha-Benzylaminobenzylphosphonic Acid Update the Mechanistic Picture and Offer New Insights into Inhibitor Design
Deposited on 2002-12-07, released 2002-12-20
The last revision prior to the SCOP 1.71 freeze date was dated 2003-05-06, with a file datestamp of 2003-05-06.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.205
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1nd5a_
  • Chain 'B':
    Domains in SCOP 1.71: d1nd5b_
  • Chain 'C':
    Domains in SCOP 1.71: d1nd5c_
  • Chain 'D':
    Domains in SCOP 1.71: d1nd5d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nd5A (A:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmttnshqgtedstd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nd5A (A:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nd5B (B:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmttnshqgtedstd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nd5B (B:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydpl
    ycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmkr
    atqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyrn
    etqhepyplmlpgcspscplerfaelvgpvipqdwstecmtt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nd5C (C:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmttnshqgtedstd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nd5C (C:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nd5D (D:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmttnshqgtedstd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nd5D (D:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt