PDB entry 1nc4

View 1nc4 on RCSB PDB site
Description: crystal structure of monoclonal antibody 2d12.5 fab complexed with gd- dota
Deposited on 2002-12-04, released 2003-12-16
The last revision prior to the SCOP 1.71 freeze date was dated 2003-12-16, with a file datestamp of 2003-12-16.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.208
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nc4A (A:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggnnnrppgv
    parfsgsligdkaaltiagtqtedeaiyfcalwysnhwvfgggtrltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslspaecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc4A (A:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggnnnrppgv
    parfsgsligdkaaltiagtqtedeaiyfcalwysnhwvfgggtrltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nc4B (B:)
    evklqesgpglvqpsqslsitctvsgfsltdygvhwvrqspgkglewlgviwsgggtayt
    aafisrlniykdnsknqvffemnslqandtamyycarrgsypynyfdvwgqgttvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc4B (B:)
    evklqesgpglvqpsqslsitctvsgfsltdygvhwvrqspgkglewlgviwsgggtayt
    aafisrlniykdnsknqvffemnslqandtamyycarrgsypynyfdvwgqgttvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nc4C (C:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggnnnrppgv
    parfsgsligdkaaltiagtqtedeaiyfcalwysnhwvfgggtrltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslspaecs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nc4D (D:)
    qvklqesgpglvqpsqslsitctvsgfsltdygvhwvrqspgkglewlgviwsgggtayt
    aafisrlniykdnsknqvffemnslqandtamyycarrgsypynyfdvwgqgttvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nc4D (D:)
    qvklqesgpglvqpsqslsitctvsgfsltdygvhwvrqspgkglewlgviwsgggtayt
    aafisrlniykdnsknqvffemnslqandtamyycarrgsypynyfdvwgqgttvtvssa
    kttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpsstwpsetvtcnvahpasstkvdkkivprd