PDB entry 1nbw

View 1nbw on RCSB PDB site
Description:
Deposited on 2002-12-04, released 2003-01-14
The last revision prior to the SCOP 1.67 freeze date was dated 2003-01-14, with a file datestamp of 2003-01-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.232
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1nbwa1, d1nbwa2, d1nbwa3
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1nbwb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1nbwc1, d1nbwc2, d1nbwc3
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1nbwd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nbwA (A:)
    mpliagidignattevalasdypqarafvasgivattgmkgtrdniagtlaaleqalakt
    pwsmsdvsriylneaapvigdvametitetiitestmighnpqtpggvgvgvgttialgr
    latlpaaqyaegwivliddavdfldavwwlnealdrginvvaailkkddgvlvnnrlrkt
    lpvvdevtlleqvpegvmaavevaapgqvvrilsnpygiatffglspeetqaivpiaral
    ignrsavvlktpqgdvqsrvipagnlyisgekrrgeadvaegaeaimqamsacapvrdir
    gepgthaggmlervrkvmasltghemsaiyiqdllavdtfiprkvqggmagecamenavg
    maamvkadrlqmqviarelsarlqtevvvggveanmaiagalttpgcaaplaildlgags
    tdaaivnaegqitavhlagagnmvslliktelgledlslaeaikkyplakveslfsirhe
    ngaveffrealspavfakvvyikegelvpidnasplekirlvrrqakekvfvtnclralr
    qvspggsirdiafvvlvggssldfeipqlitealshygvvagqgnirgtegprnavatgl
    llagqan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbwA (A:)
    pliagidignattevalasdypqarafvasgivattgmkgtrdniagtlaaleqalaktp
    wsmsdvsriylneaapvigdvametitetiitestmighnpqtpggvgvgvgttialgrl
    atlpaaqyaegwivliddavdfldavwwlnealdrginvvaailkkddgvlvnnrlrktl
    pvvdevtlleqvpegvmaavevaapgqvvrilsnpygiatffglspeetqaivpiarali
    gnrsavvlktpqgdvqsrvipagnlyisgekrrgeadvaegaeaimqamsacapvrdirg
    epgthaggmlervrkvmasltghemsaiyiqdllavdtfiprkvqggmagecamenavgm
    aamvkadrlqmqviarelsarlqtevvvggveanmaiagalttpgcaaplaildlgagst
    daaivnaegqitavhlagagnmvslliktelgledlslaeaikkyplakveslfsirhen
    gaveffrealspavfakvvyikegelvpidnasplekirlvrrqakekvfvtnclralrq
    vspggsirdiafvvlvggssldfeipqlitealshygvvagqgnirgtegprnavatgll
    lagqan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nbwB (B:)
    mslsppgvrlfydprghhagainelcwgleeqgvpcqtitydgggdaaalgalaarsspl
    rvgiglsasgeialthaqlpadaplatghvtdsddqlrtlganagqlvkvlplsern
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbwB (B:)
    ppgvrlfydprghhagainelcwgleeqgvpcqtitydgggdaaalgalaarssplrvgi
    glsasgeialthaqlpadaplatghvtdsddqlrtlganagqlvkvlplsern
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nbwC (C:)
    mpliagidignattevalasdypqarafvasgivattgmkgtrdniagtlaaleqalakt
    pwsmsdvsriylneaapvigdvametitetiitestmighnpqtpggvgvgvgttialgr
    latlpaaqyaegwivliddavdfldavwwlnealdrginvvaailkkddgvlvnnrlrkt
    lpvvdevtlleqvpegvmaavevaapgqvvrilsnpygiatffglspeetqaivpiaral
    ignrsavvlktpqgdvqsrvipagnlyisgekrrgeadvaegaeaimqamsacapvrdir
    gepgthaggmlervrkvmasltghemsaiyiqdllavdtfiprkvqggmagecamenavg
    maamvkadrlqmqviarelsarlqtevvvggveanmaiagalttpgcaaplaildlgags
    tdaaivnaegqitavhlagagnmvslliktelgledlslaeaikkyplakveslfsirhe
    ngaveffrealspavfakvvyikegelvpidnasplekirlvrrqakekvfvtnclralr
    qvspggsirdiafvvlvggssldfeipqlitealshygvvagqgnirgtegprnavatgl
    llagqan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbwC (C:)
    liagidignattevalasdypqarafvasgivattgmkgtrdniagtlaaleqalaktpw
    smsdvsriylneaapvigdvametitetiitestmighnpqtpggvgvgvgttialgrla
    tlpaaqyaegwivliddavdfldavwwlnealdrginvvaailkkddgvlvnnrlrktlp
    vvdevtlleqvpegvmaavevaapgqvvrilsnpygiatffglspeetqaivpiaralig
    nrsavvlktpqgdvqsrvipagnlyisgekrrgeadvaegaeaimqamsacapvrdirge
    pgthaggmlervrkvmasltghemsaiyiqdllavdtfiprkvqggmagecamenavgma
    amvkadrlqmqviarelsarlqtevvvggveanmaiagalttpgcaaplaildlgagstd
    aaivnaegqitavhlagagnmvslliktelgledlslaeaikkyplakveslfsirheng
    aveffrealspavfakvvyikegelvpidnasplekirlvrrqakekvfvtnclralrqv
    spggsirdiafvvlvggssldfeipqlitealshygvvagqgnirgtegprnavatglll
    agqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nbwD (D:)
    mslsppgvrlfydprghhagainelcwgleeqgvpcqtitydgggdaaalgalaarsspl
    rvgiglsasgeialthaqlpadaplatghvtdsddqlrtlganagqlvkvlplsern
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbwD (D:)
    ppgvrlfydprghhagainelcwgleeqgvpcqtitydgggdaaalgalaarssplrvgi
    glsasgeialthaqlpadaplatghvtdsddqlrtlganagqlvkvlplsern