PDB entry 1nbw

View 1nbw on RCSB PDB site
Description: Glycerol dehydratase reactivase
Class: hydrolase
Keywords: Glycerol dehydratase, Reactivase, Molecular chaperone, Actin-like ATPase domain, beta/beta/alpha swiveling domain, HYDROLASE
Deposited on 2002-12-04, released 2003-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.232
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol dehydratase reactivase alpha subunit
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: dhaB4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nbwa1, d1nbwa2, d1nbwa3
  • Chain 'B':
    Compound: glycerol dehydratase reactivase beta subunit
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: orf2b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nbwb_
  • Chain 'C':
    Compound: glycerol dehydratase reactivase alpha subunit
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: dhaB4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nbwc1, d1nbwc2, d1nbwc3
  • Chain 'D':
    Compound: glycerol dehydratase reactivase beta subunit
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: orf2b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nbwd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nbwA (A:)
    mpliagidignattevalasdypqarafvasgivattgmkgtrdniagtlaaleqalakt
    pwsmsdvsriylneaapvigdvametitetiitestmighnpqtpggvgvgvgttialgr
    latlpaaqyaegwivliddavdfldavwwlnealdrginvvaailkkddgvlvnnrlrkt
    lpvvdevtlleqvpegvmaavevaapgqvvrilsnpygiatffglspeetqaivpiaral
    ignrsavvlktpqgdvqsrvipagnlyisgekrrgeadvaegaeaimqamsacapvrdir
    gepgthaggmlervrkvmasltghemsaiyiqdllavdtfiprkvqggmagecamenavg
    maamvkadrlqmqviarelsarlqtevvvggveanmaiagalttpgcaaplaildlgags
    tdaaivnaegqitavhlagagnmvslliktelgledlslaeaikkyplakveslfsirhe
    ngaveffrealspavfakvvyikegelvpidnasplekirlvrrqakekvfvtnclralr
    qvspggsirdiafvvlvggssldfeipqlitealshygvvagqgnirgtegprnavatgl
    llagqan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbwA (A:)
    pliagidignattevalasdypqarafvasgivattgmkgtrdniagtlaaleqalaktp
    wsmsdvsriylneaapvigdvametitetiitestmighnpqtpggvgvgvgttialgrl
    atlpaaqyaegwivliddavdfldavwwlnealdrginvvaailkkddgvlvnnrlrktl
    pvvdevtlleqvpegvmaavevaapgqvvrilsnpygiatffglspeetqaivpiarali
    gnrsavvlktpqgdvqsrvipagnlyisgekrrgeadvaegaeaimqamsacapvrdirg
    epgthaggmlervrkvmasltghemsaiyiqdllavdtfiprkvqggmagecamenavgm
    aamvkadrlqmqviarelsarlqtevvvggveanmaiagalttpgcaaplaildlgagst
    daaivnaegqitavhlagagnmvslliktelgledlslaeaikkyplakveslfsirhen
    gaveffrealspavfakvvyikegelvpidnasplekirlvrrqakekvfvtnclralrq
    vspggsirdiafvvlvggssldfeipqlitealshygvvagqgnirgtegprnavatgll
    lagqan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nbwB (B:)
    mslsppgvrlfydprghhagainelcwgleeqgvpcqtitydgggdaaalgalaarsspl
    rvgiglsasgeialthaqlpadaplatghvtdsddqlrtlganagqlvkvlplsern
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbwB (B:)
    ppgvrlfydprghhagainelcwgleeqgvpcqtitydgggdaaalgalaarssplrvgi
    glsasgeialthaqlpadaplatghvtdsddqlrtlganagqlvkvlplsern
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nbwC (C:)
    mpliagidignattevalasdypqarafvasgivattgmkgtrdniagtlaaleqalakt
    pwsmsdvsriylneaapvigdvametitetiitestmighnpqtpggvgvgvgttialgr
    latlpaaqyaegwivliddavdfldavwwlnealdrginvvaailkkddgvlvnnrlrkt
    lpvvdevtlleqvpegvmaavevaapgqvvrilsnpygiatffglspeetqaivpiaral
    ignrsavvlktpqgdvqsrvipagnlyisgekrrgeadvaegaeaimqamsacapvrdir
    gepgthaggmlervrkvmasltghemsaiyiqdllavdtfiprkvqggmagecamenavg
    maamvkadrlqmqviarelsarlqtevvvggveanmaiagalttpgcaaplaildlgags
    tdaaivnaegqitavhlagagnmvslliktelgledlslaeaikkyplakveslfsirhe
    ngaveffrealspavfakvvyikegelvpidnasplekirlvrrqakekvfvtnclralr
    qvspggsirdiafvvlvggssldfeipqlitealshygvvagqgnirgtegprnavatgl
    llagqan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbwC (C:)
    liagidignattevalasdypqarafvasgivattgmkgtrdniagtlaaleqalaktpw
    smsdvsriylneaapvigdvametitetiitestmighnpqtpggvgvgvgttialgrla
    tlpaaqyaegwivliddavdfldavwwlnealdrginvvaailkkddgvlvnnrlrktlp
    vvdevtlleqvpegvmaavevaapgqvvrilsnpygiatffglspeetqaivpiaralig
    nrsavvlktpqgdvqsrvipagnlyisgekrrgeadvaegaeaimqamsacapvrdirge
    pgthaggmlervrkvmasltghemsaiyiqdllavdtfiprkvqggmagecamenavgma
    amvkadrlqmqviarelsarlqtevvvggveanmaiagalttpgcaaplaildlgagstd
    aaivnaegqitavhlagagnmvslliktelgledlslaeaikkyplakveslfsirheng
    aveffrealspavfakvvyikegelvpidnasplekirlvrrqakekvfvtnclralrqv
    spggsirdiafvvlvggssldfeipqlitealshygvvagqgnirgtegprnavatglll
    agqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nbwD (D:)
    mslsppgvrlfydprghhagainelcwgleeqgvpcqtitydgggdaaalgalaarsspl
    rvgiglsasgeialthaqlpadaplatghvtdsddqlrtlganagqlvkvlplsern
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbwD (D:)
    ppgvrlfydprghhagainelcwgleeqgvpcqtitydgggdaaalgalaarssplrvgi
    glsasgeialthaqlpadaplatghvtdsddqlrtlganagqlvkvlplsern