PDB entry 1nbg

View 1nbg on RCSB PDB site
Description: Crystal Structure of Riboflavin Kinase
Class: transferase
Keywords: beta barrel, riboflavin kinase, flavin mononucleotide
Deposited on 2002-12-02, released 2003-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2003-05-13, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein FLJ11149
    Species: HOMO SAPIENS
    Gene: FLJ11149
    Database cross-references and differences (RAF-indexed):
    • GB NP_060809 (0-146)
      • conflict (133)
    Domains in SCOPe 2.08: d1nbga_
  • Heterogens: MG, ADP, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nbgA (A:)
    rhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvhkm
    vvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisaiqg
    dieeakkrlelpeylkikednffqvsk