PDB entry 1nba

View 1nba on RCSB PDB site
Description: crystal structure analysis, refinement and enzymatic reaction mechanism of n-carbamoylsarcosine amidohydrolase from arthrobacter sp. at 2.0 angstroms resolution
Deposited on 1992-05-18, released 1994-06-22
The last revision prior to the SCOP 1.65 freeze date was dated 1994-06-22, with a file datestamp of 1994-06-24.
Experiment type: -
Resolution: 2 Å
R-factor: 0.186
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1nbaa_
  • Chain 'B':
    Domains in SCOP 1.65: d1nbab_
  • Chain 'C':
    Domains in SCOP 1.65: d1nbac_
  • Chain 'D':
    Domains in SCOP 1.65: d1nbad_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nbaA (A:)
    mtetsgtfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpg
    hpfscpgmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetl
    padsywaqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrh
    tvedaiakgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedt
    vpktlsdpqpeveapadpvfaeqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbaA (A:)
    tfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpghpfscp
    gmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetlpadsyw
    aqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrhtvedai
    akgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedtvpktls
    dpqpeveapadpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nbaB (B:)
    mtetsgtfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpg
    hpfscpgmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetl
    padsywaqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrh
    tvedaiakgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedt
    vpktlsdpqpeveapadpvfaeqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbaB (B:)
    fndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpghpfscpg
    metiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetlpadsywa
    qiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrhtvedaia
    kgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedtvpktlsd
    pqpeveapadpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nbaC (C:)
    mtetsgtfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpg
    hpfscpgmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetl
    padsywaqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrh
    tvedaiakgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedt
    vpktlsdpqpeveapadpvfaeqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbaC (C:)
    tfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpghpfscp
    gmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetlpadsyw
    aqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrhtvedai
    akgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedtvpktls
    dpqpeveapadpv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nbaD (D:)
    mtetsgtfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpg
    hpfscpgmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetl
    padsywaqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrh
    tvedaiakgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedt
    vpktlsdpqpeveapadpvfaeqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nbaD (D:)
    tfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpghpfscp
    gmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetlpadsyw
    aqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrhtvedai
    akgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedtvpktls
    dpqpeveapadpv