PDB entry 1nb9

View 1nb9 on RCSB PDB site
Description: Crystal Structure of Riboflavin Kinase
Class: transferase
Keywords: transferase, beta barrel, riboflavin, riboflavin kinase
Deposited on 2002-12-02, released 2003-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.185
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein FLJ11149
    Species: Homo sapiens [TaxId:9606]
    Gene: FLJ11149
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969G6 (0-146)
      • conflict (133)
    Domains in SCOPe 2.08: d1nb9a_
  • Heterogens: MG, ADP, RBF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nb9A (A:)
    rhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvhkm
    vvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisaiqg
    dieeakkrlelpeylkikednffqvsk