PDB entry 1nb8

View 1nb8 on RCSB PDB site
Description: Structure of the catalytic domain of USP7 (HAUSP)
Class: hydrolase
Keywords: UBP, deubiquitination, HAUSP, p53 binding
Deposited on 2002-12-02, released 2003-01-07
The last revision prior to the SCOP 1.75 freeze date was dated 2003-01-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 7
    Species: HOMO SAPIENS
    Gene: USP7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93009 (0-End)
      • modified residue (17)
      • modified residue (36-37)
      • modified residue (84)
      • modified residue (103)
      • modified residue (120)
      • modified residue (199)
      • modified residue (202)
      • modified residue (307)
    Domains in SCOP 1.75: d1nb8a_
  • Chain 'B':
    Compound: Ubiquitin carboxyl-terminal hydrolase 7
    Species: HOMO SAPIENS
    Gene: USP7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93009 (0-End)
      • modified residue (17)
      • modified residue (36-37)
      • modified residue (84)
      • modified residue (103)
      • modified residue (120)
      • modified residue (199)
      • modified residue (202)
      • modified residue (307)
    Domains in SCOP 1.75: d1nb8b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nb8A (A:)
    kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
    qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
    mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
    eaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpan
    yilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsv
    rhctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqkrkerqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nb8A (A:)
    kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
    qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
    mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
    eaekgvkfltlppvlhlqlmrfmikindrfefpeqlpldeflqktdpkdpanyilhavlv
    hsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghhctnaymlvyires
    klsevlqavtdhdipqqlverlqeekrieaqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nb8B (B:)
    kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
    qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
    mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
    eaekgvkfltlppvlhlqlmrfmydpqtdqnikindrfefpeqlpldeflqktdpkdpan
    yilhavlvhsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghdddlsv
    rhctnaymlvyiresklsevlqavtdhdipqqlverlqeekrieaqkrkerqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nb8B (B:)
    kkhtgyvglknqgatcymnsllqtlfftnqlrkavymmptegddssksvplalqrvfyel
    qhsdkpvgtkkltksfgwetldsfmqhdvqelcrvlldnvenkmkgtcvegtipklfrgk
    mvsyiqckevdyrsdrredyydiqlsikgkknifesfvdyvaveqldgdnkydagehglq
    eaekgvkfltlppvlhlqlmrfmikindrfefpeqlpldeflqktdpkdpanyilhavlv
    hsgdnhgghyvvylnpkgdgkwckfdddvvsrctkeeaiehnygghhctnaymlvyires
    klsevlqavtdhdipqqlverlqeekrieaqkr