PDB entry 1nb0

View 1nb0 on RCSB PDB site
Description: Crystal Structure of Human Riboflavin Kinase
Class: transferase
Keywords: beta barrel, transferase
Deposited on 2002-12-01, released 2003-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein FLJ11149
  Species: Homo sapiens [TaxId:9606]
  Gene: FLJ11149
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q969G6 (0-146)
    • conflict (133)
  Domains in SCOPe 2.06: d1nb0a_
• Heterogens: MG, ADP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nb0A (A:)
  rhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvhkm
  vvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisaiqg
  dieeakkrlelpeylkikednffqvsk